The short version of reconstitution fits in a sentence. The long version — which is the one that helps — is below.
Reviewed 2026-01-10. Anything still debated is marked as such rather than presented as settled.
Temperature is a primary factor because most degradation reactions proceed more slowly at lower temperatures. Lyophilized peptides are commonly held at -20 °C or below, although some sequences remain stable at 2–8 °C for limited periods. Moisture uptake during handling can accelerate hydrolysis, so sealed containers and desiccants are used. Solutions are generally less stable than powders and may require freezing at -80 °C or refrigeration, depending on the peptide. Repeated freeze-thaw cycles can promote aggregation even when the storage temperature is otherwise suitable.
Light, oxygen, and pH influence peptide integrity through specific side-chain reactions. Methionine and cysteine residues are susceptible to oxidation, and tryptophan can degrade under strong light. Inert gas overlays and amber glass or opaque containers reduce these risks. pH affects charge, solubility, and the rate of deamidation or aggregation; a value that minimizes one pathway may increase another. The optimal pH and buffer for a given peptide are often determined experimentally, and open questions remain about predicting stability from sequence alone.
Peptides are short chains of amino acids linked by amide bonds, and their storage stability depends on sequence, length, and three-dimensional structure. Chemical degradation can occur through hydrolysis, oxidation, deamidation, and aggregation, while physical changes such as precipitation or surface adsorption reduce recovery. Storage conditions are chosen to slow these processes without altering the peptide itself. Because peptides vary widely, no single condition suits every sequence, so laboratories often establish stability empirically for each batch.
Lyophilization removes water under vacuum from a frozen solution, leaving a porous cake or powder. Formulation excipients such as sugars or polyols can stabilize structure during freezing and drying and can raise the glass transition temperature. Residual moisture in the final product remains a critical variable because even small amounts can support hydrolysis over time. Storage recommendations often specify desiccation, darkness, and low temperature, though exact conditions depend on the peptide and its intended use. Stability studies measure changes under defined conditions rather than predicting absolute shelf life.
Peptides are short chains of amino acids linked by amide bonds. Their stability depends on sequence, length, and the chemical environment. Common degradation routes include hydrolysis of the peptide backbone, oxidation of methionine or cysteine residues, deamidation of asparagine or glutamine, and aggregation through hydrophobic or electrostatic interactions. These processes can alter mass, charge, or biological activity, so storage conditions aim to slow them. The relative importance of each route varies widely among peptides.
Water is a central factor in peptide degradation because it enables hydrolysis and mobilizes reactive species. Lyophilized or dry powders typically remain stable for longer than solutions when kept cool and dry. Oxygen can drive oxidation, particularly for sulfur-containing residues, while light can catalyze side-chain damage. Buffer choice and pH influence charge state and can accelerate or slow deamidation and aggregation. Freeze-thaw cycles may concentrate solutes or promote ice-induced aggregation, so minimizing such cycles is a common handling goal.
| Property | Value | Notes |
|---|---|---|
| Appearance (lyophilized) | White to off-white powder | May appear fluffy, crystalline, or amorphous depending on manufacturing |
| Solubility class | Typically water-soluble | Solubility varies with sequence and pH; some require organic co-solvents |
| Typical storage temperature (lyophilized) | -20 °C or lower | Some peptides tolerate 2–8 °C; moisture control is critical |
| Typical storage temperature (solution) | -80 °C to 2–8 °C | Depends on peptide; avoid repeated freeze-thaw cycles |
| Common analytical method | Reverse-phase HPLC | Used for purity, identity, and degradation monitoring; mass spectrometry often confirms mass |
Reconstitution is often performed with sterile water, buffer, or a water-miscible organic solvent, depending on solubility. The solvent should be added gently along the vial wall, and the solution mixed by gentle swirling rather than vigorous vortexing, which can cause foaming and surface denaturation. Some sequences require a small amount of base or acid to dissolve, followed by pH adjustment. Preparing a concentrated stock solution can simplify later dilution, but the stock itself may have limited stability. Records of solvent, concentration, and date support reproducibility.
After reconstitution, dividing the solution into single-use aliquots limits multiple warming and cooling events and reduces contamination risk. Low-binding polypropylene tubes are often preferred because peptides can adsorb to glass or untreated plastic surfaces. Filling headspace with nitrogen or argon can slow oxidation, and amber or foil-wrapped containers reduce photodegradation. Each aliquot should be labeled with peptide identity, concentration, date, and storage conditions. Frozen aliquots should be thawed quickly and kept on ice until use.
Moisture, oxygen, and light also affect peptide integrity. Lyophilized powders absorb water from the air, which can enable hydrolysis and conformational changes. Oxygen promotes oxidation of sensitive residues, so storage under inert gas or in sealed vials is common. Light exposure can cause photodegradation, particularly for peptides containing aromatic amino acids. Buffer choice and pH influence charge state and solubility; extremes of pH accelerate deamidation and hydrolysis. Adding stabilizers such as sugars or polyols can protect the peptide during freezing and drying. Optimal conditions are determined empirically for each peptide.
Peptides are short chains of amino acids that can undergo both chemical and physical degradation. Chemical pathways include hydrolysis of peptide bonds, oxidation of methionine or cysteine residues, deamidation of asparagine or glutamine, and isomerization of aspartate. Physical instability leads to aggregation, precipitation, or adsorption to surfaces. The rate of these processes depends on the peptide sequence, the formulation, and the storage environment. Because each peptide has a unique composition, no single storage condition applies to all peptides. Stability studies are therefore conducted to define suitable conditions for each specific molecule.
Although no sovereign Polish state existed between 1795 and 1918, the idea of Polish independence was kept alive throughout the 19th century. There were a number of uprisings and other armed undertakings waged against the partitioning powers. Military efforts after the partitions were first based on the alliances of Polish émigrés with post-revolutionary France. Jan Henryk Dąbrowski's Polish Legions fought in French campaigns outside of Poland between 1797 and 1802 in hopes that their involvement and contribution would be rewarded with the liberation of their Polish homeland. The Polish national anthem, "Poland Is Not Yet Lost", or "Dąbrowski's Mazurka", was written in praise of his actions by Józef Wybicki in 1797. The Duchy of Warsaw, a small, semi-independent Polish state, was created in 1807 by Napoleon in the wake of his defeat of Prussia and the signing of the Treaties of Tilsit with Emperor Alexander I of Russia. The Army of the Duchy of Warsaw, led by Józef Poniatowski, participated in numerous campaigns in alliance with France, including the successful Austro-Polish War of 1809, which, combined with the outcomes of other theaters of the War of the Fifth Coalition, resulted in an enlargement of the duchy's territory. The French invasion of Russia in 1812 and the German Campaign of 1813 saw the duchy's last military engagements. The Constitution of the Duchy of Warsaw abolished serfdom as a reflection of the ideals of the French Revolution, but it did not promote land reform.
The 16th century Spanish missionary and naturalist José de Acosta noted the supposed aphrodisiac power of chilies, but wrote that they were harmful to people's spiritual health. In the 1970s, the government of Peru forbade prison inmates to consume chilies, their explanation being that these were "not appropriate for men forced to live a limited lifestyle."
== Decreased GFR == A decreased renal function can be caused by many types of kidney disease. Upon presentation of decreased renal function, it is recommended to perform a history and physical examination, as well as performing a renal ultrasound and a urinalysis. The most relevant items in the history are medications, edema, nocturia, gross hematuria, family history of kidney disease, diabetes and polyuria. The most important items in a physical examination are signs of vasculitis, lupus erythematosus, diabetes, endocarditis and hypertension. A urinalysis is helpful even when not showing any pathology, as this finding suggests an extrarenal etiology. Proteinuria and/or urinary sediment usually indicates the presence of glomerular disease. Hematuria may be caused by glomerular disease or by a disease along the urinary tract. The most relevant assessments in a renal ultrasound are renal sizes, echogenicity and any signs of hydronephrosis. Renal enlargement usually indicates diabetic nephropathy, focal segmental glomerular sclerosis or myeloma. Renal atrophy suggests longstanding chronic renal disease.
In a meeting of the Quadrilateral Security Dialogue on the implications of the 2022 Russian invasion of Ukraine for the region, President Biden noted India's abstention, saying that most global allies were united against Russia. Speaking to the US Senate Foreign Relations Committee, US diplomat Donald Lu said the Biden administration was still considering sanctions against India over its S-400 deal with Russia, and its abstention at the UN. However, the Biden administration has ruled out secondary sanctions against India for its considerable oil imports or defence engagement from Russia.
== Overview of peripheral regeneration == Wallerian degeneration is a process that occurs before nerve regeneration and can be described as a cleaning or clearing process that essentially prepares the distal stump for reinnervation. Schwann cells are glial cells in the peripheral nervous system that support neurons by forming myelin that encases nerves. During Wallerian degeneration Schwann cells and macrophages interact to remove debris, specifically myelin and the damaged axon, from the distal injury site. Calcium has a role in the degeneration of the damage axon. Bands of Büngner are formed when uninnervated Schwann cells proliferate and the remaining connective tissue basement membrane forms endoneurial tubes. Bands of Büngner are important for guiding the regrowing axon. At the neuronal cell body, a process called chromatolysis occurs in which the nucleus migrates to the periphery of the cell body and the endoplasmic reticulum breaks up and disperses. Nerve damage causes the metabolic function of the cell to change from that of producing molecules for synaptic transmission to that of producing molecules for growth and repair. These factors include GAP-43, tubulin and actin. Chromatolysis is reversed when the cell is prepared for axon regeneration. Axon regeneration is characterized by the formation of a growth cone, which has the ability to produce a protease that digests any material or debris that remains in its path of regeneration toward the distal site. The growth cone responds to molecules produced by Schwann cells such as laminin and fibronectin.
Sources: en.wikipedia.org
A 4th period, also described as "The third style" receives strong influence from Chinese painting, a result of the artistic activity and expansion of the Tang dynasty. The civilization of Kucha, with the whole Tarim Basin from Turfan to Khotan, fell to the Chinese punitive invasion of 648 CE, putting an end to the Indo-Iranian styles of Kucha. Ashina She'er, the East Turkic general leading the Tang dynasty expeditionary corps, ordered the execution of eleven thousand Kuchean inhabitants by decapitation. It was recorded that "he destroyed five great towns and with them many myriads of men and women... the lands of the west were seized with terror." Two caves at Kizil have art of the Tang period: cave 43 and cave 229. In nearby Kumtura and in Turfan, Chinese styles now prevailed. In 670 CE, the Tibetan Empire conquered most of the Tarim Basin, including Khotan, Kucha, Karashahr and Kashgar, which they kept until the Chinese took back the control of the area in 692. In 753 CE, the northern part of the Tarim Basin was taken over by the Turks of the Uyghur Khaganate, based in Turfan. A new Tibetan conquest took place in 790 CE. By 900 CE, the area was under Muslim domination.
Another fissile isotope, uranium-233, can be produced from natural thorium and is studied for future industrial use in nuclear technology. Uranium-238 has a small probability for spontaneous fission or even induced fission with fast neutrons; uranium-235, and to a lesser degree uranium-233, have a much higher fission cross-section for slow neutrons. In sufficient concentration, these isotopes maintain a sustained nuclear chain reaction. This generates the heat in nuclear power reactors and produces the fissile material for nuclear weapons. The primary civilian use for uranium harnesses the heat energy to produce electricity. Depleted uranium (238U) is used in kinetic energy penetrators and armor plating. The 1789 discovery of uranium in the mineral pitchblende is credited to Martin Heinrich Klaproth, who named the new element after the recently discovered planet Uranus. Eugène-Melchior Péligot was the first person to isolate the metal, and its radioactive properties were discovered in 1896 by Henri Becquerel. Research by Otto Hahn, Lise Meitner, Enrico Fermi and others (including J. Robert Oppenheimer), beginning in 1934, led to its use as a fuel in the nuclear power industry and in Little Boy, the first nuclear weapon used in war. An ensuing arms race during the Cold War between the United States and the Soviet Union produced tens of thousands of nuclear weapons that used uranium metal and uranium-derived plutonium-239. Dismantling of these weapons and related nuclear facilities is carried out within various nuclear disarmament programs and costs billions of dollars.
== Honey bees == Honey bees deposit vitellogenin molecules in fat bodies in their abdomen and heads. The fat bodies apparently act as a food storage reservoir. The glycolipoprotein vitellogenin has additional functionality as it acts as an antioxidant to prolong Queen bee and forager lifespan as well as a hormone that affects future foraging behavior. The health of a honey bee colony is dependent upon the vitellogenin reserves of the nurse bees – the foragers having low levels of vitellogenin. As expendable laborers, the foragers are fed just enough protein to keep them working their risky task of collecting nectar and pollen. Vitellogenin levels are important during the nest stage and thus influence honey bee worker division of labor. A nurse bee's vitellogenin titer that developed in the first four days after emergence, affects its subsequent age to begin foraging and whether it preferentially forages for nectar or pollen. If young workers are short on food their first days of life, they tend to begin foraging early and preferentially for nectar. If they are moderately fed, they forage at normal age preferentially for nectar. If they are abundantly fed, immediately after emergence, their vitellogenin titer is high and they begin foraging later in life, preferentially collecting pollen. Pollen is the only available protein source for honey bees.
== External links == The idea of antiangiogenesis was pioneered by Dr. Judah Folkman. See [1] and [2] Angiogenesis Inhibitors for Cancer – from The Angiogenesis Foundation, 23 June 2009 Angiogenesis Inhibitors for Eye Disease – from The Angiogenesis Foundation, 23 June 2009 Angiogenesis Inhibitors in the Treatment of Cancer – from the National Cancer Institute Angiogenesis+Inhibitors at the U.S. National Library of Medicine Medical Subject Headings (MeSH)
Sources: en.wikipedia.org
== Chemistry == Grammotoxin is a 36 amino acid protein toxin, with the sequence Asp-Cys-Val-Arg-Phe-Trp-Gly-Lys-Cys-Ser-Gln-Thr-Ser-Asp-Cys-Cys-Pro-His-Leu-Ala-Cys-Lys-Ser-Lys-Trp-Pro-Arg-Asn-Ile-Cys-Val-Trp-Asp-Gly-Ser-Val (DCVRFWGKCSQTSDCCPHLACKSKWPRNICVWDGSV), and disulfide bridges between Cys2-Cys16, Cys9-Cys21 and Cys15-Cys30. It forms an inhibitor cystine knot motif, common in spider toxins. Its chemical formula is: C177H268N52O50S6 Grammotoxin can be purified from Grammostola spatulata venom by reverse phase high performance liquid chromatography.
Meyer (1940), composer, author, philosopher known for his contributions to the aesthetic theory of music Orrin Keepnews (1943), jazz record producer and winner of the 1988 Grammy Award for Best Album Notes and Best Historical Album Mort Lindsey (1944), musical director for Judy Garland and Merv Griffin Dick Hyman (1948), musical director for Arthur Godfrey; composer or arranger for Hannah and Her Sisters and The Purple Rose of Cairo; Emmy Award winner Philip Springer (1950), composer known for writing the song "Santa Baby" Randy Starr (1951), dentist and composer for Elvis Presley Eric Salzman (1954), composer, producer, critic; founder of the American Music Theater Festival and composer-in-residence of the Center for Contemporary Opera Malcolm Frager (1955), piano virtuoso Mike Berniker (1957), musical producer and winner of nine Grammy Awards Billy Goldenberg (1957), composer and winner of four Emmy Awards John Corigliano (1959), winner of the Pulitzer Prize for Music and Academy Award for Best Original Score Edward Kleban (1959), lyricist for A Chorus Line David Bromberg* (1960s), Grammy Award-nominated musician Art Rosenbaum (1960), Grammy Award-winning art professor and musician at Georgia State University Charles Wuorinen (1961), serialist composer and winner of the Pulitzer Prize for Music for Time's Encomium Charlie Morrow (1962), sound artist and musician Joel Krosnick (1963), chamber musician and member of the Juilliard String Quartet David Rubinson (1963), record and music producer of Apocalypse Now, founder of San Francisco Records and The Automatt recording studio Art Garfunkel (1965), singer of Simon and Garfunkel, famous for the song "The Sound of Silence" Daniel Waitzman (1965), flutist and composer Kenneth Ascher (1966), Academy Award-nominated jazz pianist; writer of "Rainbow Connection" from The Muppet Movie David Schiff (1967), composer Tom Werman (1967), former record producer for Epic Records Billy Cross (1968), guitarist, singer, and producer who lives in Denmark Jon Bauman (1969), "Bowzer" of Sha Na Na James "Plunky" Branch (1969), jazz musician Cameron Brown (1969), jazz bassist Emanuel Ax (1970), concert pianist Marc Copland (1970), jazz pianist and composer Scott Simon (1970), member of Sha Na Na Frederick "Dennis" Greene (1971), member of Sha Na Na; professor of law at the University of Dayton Armen Donelian (1972), jazz pianist Jocko Marcellino (1972), member of Sha Na Na Phil Schaap (1973), Charlie Parker authority and multiple Grammy Award winner for engineering, production, and album notes Eugene Drucker (1973), Grammy Award-winning violinist, member of the Emerson String Quartet Sam Morrison (1973), saxophonist Michael Jeffrey Shapiro (1973), composer and conductor Richard Einhorn (1975), composer, Voices of Light Phil Kline (1975), composer Paul Phillips (1978), conductor, composer, and music scholar at Brown University Erik Friedlander (1982), cellist, son of American photographer Lee Friedlander Robbie Fulks* (1984), Grammy Award-nominated American alternative country singer-songwriter Dave Nachmanoff (1986), award-winning folk singer and sideman to Al Stewart John Bohlinger (1988), musician and music director on NBC program Nashville Star Laura Cantrell (1989), country musician Peter J. Nash (1989), member of 3rd Bass Mac McCaughan (1990), member of indie rockband Superchunk and founder of Merge Records Richard Carrick (1993), pianist, composer, professor at Berklee College of Music Gil Shaham (1993), violinist Jefferson Friedman (1996), composer Tom Kitt (1996), composer, co-winner of the 2010 Pulitzer Prize for Drama and the Tony Award for Best Original Score for his score of the musical Next to Normal R. Luke DuBois (1997), composer and artist Lauryn Hill* (1997), Grammy Award-winning R&B singer and songwriter, and member of The Fugees Sean Lennon* (1997), singer and songwriter, and son of John Lennon and Yoko Ono Orli Shaham (1997), pianist Yelena Dudochkin (1998), Ukrainian-American soprano Scott Hoffman (1999), known by the stage name Babydaddy, member of the rock band Scissor Sisters The Two Man Gentlemen Band, modern musical duo that consists of Fuller Condon (2000) and Andy Bean (2001) Mason Bates (2000), Grammy Award-winning composer Tom Frank (2000), journalist, former member of indie-rock band Jonathan Fire*Eater Hikaru Utada* (2000), Japanese pop star Alicia Keys* (2001), Grammy Award-winning R&B singer and songwriter Brian Weitz (2001), founding member of experimental band Animal Collective Emily and Julia Bruskin (2002), members of the Claremont Trio Ken-David Masur (2002), musical director of the Milwaukee Symphony Orchestra, son of conductor Kurt Masur Ariana Ghez (2003), oboist Nico Muhly (2003), contemporary classical music composer Anna Bulbrook (2004), violinist formerly member of indie band The Airborne Toxic Event Alisa Weilerstein (2004), cellist and 2011 MacArthur Fellow Tristan Perich (2004), contemporary composer and sound artist Peter Cincotti (2005), pianist Ellen Reid (2005), composer and recipient of the 2019 Pulitzer Prize for Music Patrick Higgins (2006), composer, musician, producer Michael Barimo (2006), pop singer and whistler Rostam Batmanglij (2006), member of alt-rock band Vampire Weekend Ezra Koenig (2006), member of alt-rock band Vampire Weekend Chris Tomson (2006), member of alt-rock band Vampire Weekend Chris Baio (2007), member of alt-rock band Vampire Weekend Call Me Ace or Anthony Patterson (2011), rapper Adam Met (2013), member of pop band AJR Danny Mercer (2013), singer, songwriter and producer Nathan Chan (2014), cellist Conrad Tao (2015), composer, pianist, violinist Jack Met* (2019), member of pop band AJR Maude Latour (2022), singer-songwriter Annie Moon (2026), member of a co-ed K-Pop Group ALLDAY PROJECT
=== Monitoring and prediction === People with loss of feeling in their feet should inspect their feet on a daily basis to ensure that there are no wounds starting to develop. Monitoring a person's feet can help in predicting the likelihood of developing ulcers. A common method for this is using a special thermometer to look for spots on the foot that have a higher temperature, which indicate the possibility of an ulcer developing. At the same time there is no strong scientific evidence supporting the effectiveness of at-home foot temperature monitoring. The current guideline in the United Kingdom recommends collecting 8-10 pieces of information for predicting the development of foot ulcers. A simpler method proposed by researchers provides a more detailed risk score based on three pieces of information (insensitivity, foot pulse, previous history of ulcers or amputation). This method is not meant to replace people regularly checking their own feet, but to complement it.
Henriksen played the android Bishop in Cameron's film Aliens (1986), and as Bishop's designer Michael Weyland in Alien 3 (1992). He also played Charles Bishop Weyland, the man upon whom Bishop was based, in Alien vs. Predator (2004). Bill Paxton and Henriksen are the only actors whose characters were killed by the Terminator, the Alien, and the Predator. He played the vampire leader Jesse Hooker in Kathryn Bigelow's cult film Near Dark. He portrayed gunfighters in the Westerns Dead Man and The Quick and the Dead, and appeared with British actor Bruce Payne in Aurora: Operation Intercept in 1995. That year, he also played Sheriff Doug Barnum in the film Powder. He appeared with Payne again in Face the Evil (1997), and the dystopian classic Paranoia 1.0 (2004). In 1996, Henriksen starred in the television series Millennium, created and produced by Chris Carter, the creator of The X-Files. Henriksen played Frank Black, a former FBI agent who possessed a unique ability to see into the minds of killers. Carter created the role specifically for the actor. His performances on Millennium earned him critical acclaim, a People's Choice Award nomination for Favorite New Male TV Star, and three consecutive Golden Globe nominations for Best Performance by an Actor in a TV Series (1997–1999). The series was canceled in 1999. On television, Henriksen appeared in the ensemble of Into the West (2005), a miniseries executive-produced by Steven Spielberg. He appeared in a Brazilian soap opera, Caminhos do Coração (Ways of the Heart) from Rede Record, aired in 2007–2008.
Pickled tofu (豆腐乳 in Chinese, pinyin: dòufurǔ, or 腐乳 fŭrŭ; chao in Vietnamese), also called "preserved tofu" or "fermented tofu", consists of cubes of dried tofu that have been allowed to fully air dry under hay and slowly ferment with the help of aerial bacteria. The dry fermented tofu is then soaked in salt water, Chinese rice wine, vinegar or minced chili peppers, or in a mixture of whole rice, bean paste, and soybeans. In the case of red pickled tofu (紅豆腐乳 in Chinese, Pinyin: hóng dòufurǔ), red yeast rice (cultivated with Monascus purpureus) is added for color. In Japan, pickled tofu with miso paste is called tofu no misodzuke, and is a traditional preserved food in Kumamoto. In the Ryukyu Islands, pickled and fermented tofu is called tōfuyō (豆腐餻). It is made from Shima-dōfu (an Okinawan variety of large and firm tofu). It is fermented and matured with koji mold, red koji mold, and awamori. Stinky tofu (臭豆腐 in Chinese, Pinyin: chòudòufu) is soft tofu that has been fermented in a vegetable and fish brine. The blocks of tofu have a pungent cheese smell, sometimes resembling rotting food. Despite its strong odor, the flavor and texture of stinky tofu is appreciated by aficionados, who describe it as delightful. The texture of this tofu is similar to the soft East Asian tofu from which it is made. The rind that stinky tofu develops when fried is said to be best when especially crisp, and fried stinky tofu is usually served with soy sauce, sweet sauce, or hot sauce.
Sources: en.wikipedia.org
Removing water reduces hydrolytic and some oxidative degradation. Powder forms are generally more stable for long-term storage than solutions. Stability still depends on peptide sequence, residual moisture, and container conditions.
Freezing slows most chemical reactions, but it can also concentrate solutes and promote aggregation during freezing or thawing. Repeated freeze-thaw cycles are often more damaging than constant cold storage. Some peptides require specific buffers or additives to remain soluble.
pH affects charge, solubility, and the reactivity of amino acid side chains. It can influence deamidation, oxidation, and aggregation pathways. The best pH is peptide-specific and is usually identified through stability testing.
Peptide degradation can arise from hydrolysis, oxidation, deamidation, and aggregation. The dominant route depends on the peptide sequence and the storage environment. Temperature, moisture, oxygen, light, and pH all influence the rate.